DPCstruct | MC32460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 295 ± 54 aa |
| Standard deviation of domain lengths | 54.19 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.69 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | PF06025- PF06012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816U511 | 24-245 | MILAEHPLPEDKQIKLFTHLRLAYAFPSFEQRLLCIQARLHALLILIYSSRVQEANRVLYDGLIQELVKVLNVRDSSLTDIKVSALK… |
| A0A3P7NAC9 | 10-279 | IIEEERASLIARLRLVRSFSTVRGRQLIIIARLLASSILMYSRNLAEDWTITAMLYDGFIGELTTLLMIEDVFDPLIDTIKTESLRT… |
| A0A7R8D858 | 272-633 | None |
| A0A183F620 | 224-521 | None |
| A0A0E0QNK9 | 227-488 | None |
| A0A836AJA7 | 1-344 | None |
| A0A4V5NAB4 | 150-414 | None |
| A0A3M0LAX0 | 3-215 | None |
| A0A444UWM6 | 66-300 | None |
| A0A0D6LJF2 | 97-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.