DPCstruct | MC32458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 244 ± 22 aa |
| Standard deviation of domain lengths | 21.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816LGV1 | 123-367 | ASHEFKSDTFLRVAMSVLPVAAVLSYQIDAIWQLQIRNMYAGLSSTILHIFYFLQFYIHLKGNSKTIANIYTYVYHIIIWIFKTGGN… |
| A0A816SPL3 | 1-277 | MIILPFVSSSCYVFDAWYHYIYHPPSRNYEGLLSTIVIVFIYLQYCAPIRSRYALGIYHILLWIIIEIANLGYLIFYIQQRDTFRII… |
| A0A813XE88 | 1-275 | None |
| A0A818K4G9 | 7-206 | None |
| A0A818CJF0 | 145-393 | None |
| A0A815VS96 | 12-238 | None |
| A0A820VNG6 | 11-242 | None |
| A0A818X5A6 | 14-270 | None |
| A0A821UNM5 | 70-308 | None |
| A0A814KPW0 | 1-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.