DPCstruct | MC32454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 212 ± 35 aa |
| Standard deviation of domain lengths | 34.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816S3I4 | 31-236 | VRTQVKERLDRSEIVPDAMFVYKCSDACPYMFHFEGCGRPYELSKCPMCKADIGATSYNNPIIRIPPQLQMPIEAGFQFIADYIKTY… |
| A0A2I1HVK1 | 1-199 | MGTSFYSCICGYRYFIGECGKPVATGSCPDCGKMIGGSDHVPVAGNNRIQIQPLAINHLTGYVGELVSQNMNHFVRSLRPIAYRILH… |
| A0A2Z6Q3E2 | 8-186 | None |
| A0A7J5ZWA1 | 355-511 | None |
| A0A821PUE4 | 2-244 | None |
| U9UUB4 | 1-174 | None |
| A0A819XCS6 | 745-958 | None |
| A0A817FUW3 | 2-244 | None |
| A0A822G661 | 189-437 | None |
| A0A822CEW1 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.