DPCstruct | MC32437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 186 ± 33 aa |
| Standard deviation of domain lengths | 32.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5QDZ4 | 15-202 | GWAYAKRSCKKQKKKVHRVFTRSMSVGVLHGGKLALERVIDYHRARADEASLKAAEKELKDLLIEEHPDFVKLQSTVAMLEMSGKEA… |
| A0A5D3CMZ4 | 2-165 | RANPEKKDKYLKKLDTKIESDLPDFLKLQNIVAKLEMLGQEDKVIEKLKIAAEKAEKSFPLYEYEYQMLLVELYIYKGEFAKAEELP… |
| V4MAD1 | 16-214 | None |
| A0A6A6LZ66 | 1-129 | None |
| A0A5D2G927 | 3-142 | None |
| A0A151RWC2 | 3-221 | None |
| A0A6J5WZ97 | 18-233 | None |
| A0A834X8N6 | 78-263 | None |
| A0A6J1EIU2 | 37-260 | None |
| A0A6A3AYV2 | 5-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.