DPCstruct | MC32435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 57.78 |
| Assigned Pfam label(s) | CL0127- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5Q549 | 175-296 | SRLRTSTNGSDFALKENSNDLGVTQKYKHLWVQCEICYGLNYKKFFKSKMNICEQCGYHLKMSSSDRIELSIDPGTWDPMDEEMFSL… |
| A0A6A4PWL3 | 17-89 | VCEHCGYHLKMSSSDRIELLIDSGTWNPMDEDMVSLDPIEFHSEEEPYKDRIDSYQRKIGLTEAVQTGTGQLN |
| A0A855HJ23 | 15-125 | None |
| A0A1A9UK92 | 190-279 | None |
| A0A6A0JKF2 | 28-127 | None |
| A0A5N6NCX3 | 310-392 | None |
| A0A1W5YRJ5 | 197-294 | None |
| A0A4D6C3T6 | 2-96 | None |
| A0A357D0H8 | 7-112 | None |
| Q2EEX4 | 41-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.