DPCstruct | MC32431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 135 ± 26 aa |
| Standard deviation of domain lengths | 26.45 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848ED12 | 24-146 | ASLAFIGRIRTPFATRTECPHRGRTDGPDCRIEVDAPWRPALRGIAAGDRLEVLYWMHLARRDLLVQVPKGRAATGTFALRSPNRPN… |
| A0A524N654 | 8-120 | FIGRVTRVEEDISTIMIYPEFCEGLYRLDEYTHLNILFWFHQRDDNEHRNVLRVVPRRHGETEERGVFASHSPSRPNPIGLTVVELV… |
| F4PTI8 | 248-332 | None |
| A0A0D0S4R5 | 2-115 | None |
| A0A7S4NNU4 | 110-267 | None |
| A0A0G4HAZ6 | 57-258 | None |
| A0A0P1B6V7 | 156-316 | None |
| A0A0G4HQH0 | 1-217 | None |
| A0A3A5ACK8 | 5-139 | None |
| A0A5B8MWE6 | 86-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.