DPCstruct | MC3243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 24.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9XEI2 | 21-124 | MYLARVKNVYSPTQKMWGEPAPEAYDETIQGTEIVLRSWSRQMTSPLSNKYTWYKGGSLSLAIKTLTGKEPEFYLSDVRDPDRASMV… |
| A0A7S0CM88 | 4-102 | AKCYINWGGYAYSTKSPEGVDARAEFTHRLTSVKVAIHNQDDREHDIFDSDDYFQFHGGMIATIQALSKDGTKPKGYFGDTQNPDRP… |
| A0A0C1UB24 | 2-91 | None |
| A0A1R3L6Z5 | 108-212 | None |
| A0A7C4J853 | 82-152 | None |
| A0A7C2WM10 | 1-92 | None |
| A0A0U1L415 | 9-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.