DPCstruct | MC32428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 946 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.73 |
| Pfam Score | 95.53 |
| Assigned Pfam label(s) | PF07793- PF07238- PF12945- CL0110- PF00015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8WRL0 | 139-258 | KAKGMRKFVRMNCQGVRNTEAFFLSGNMMYKMEVLDISSIGMGLKIPLKYCQLFRINTVIPGLNIVLGSKQLKVNAKIFGIKNLGNA… |
| A0A1G1P7C7 | 2-106 | KERRQYKRIRIDLPAQCKIYGPSEICFSTKVYDISPGGICFLTNDKIELGTQAEIQIKLDNNEKITMKAKVTWSEGPQGAEPARAGV… |
| A0A1F9CMM4 | 593-704 | None |
| D4L3W2 | 598-697 | None |
| A0A7C4LWB3 | 252-355 | None |
| M1F7T9 | 1-74 | None |
| A0A7X7XGD0 | 1-89 | None |
| A0A1Y6B3C2 | 30-131 | None |
| A0A1Y6BUX0 | 2-104 | None |
| A0A1E4ZJA7 | 8-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.