DPCstruct | MC32427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 167 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2Z0Z0 | 62-223 | TVPIFLRLGNRARAYEKGQAKPDVGRLRNVMISNIVATDCSAIGCSIKGLPGHLIENVTLSNVSLGFNGGGTREDAAREIPERPDSY… |
| A0A520GE31 | 4-168 | LTTAPLFIRLGRRMRAPPGSQVGAIRRVNISNVVVSGANAPFASIVAGLPEAPVEDVRISNLTVVHGGGGTAADAVRQVPEEADHYP… |
| R6BYW2 | 576-741 | None |
| A0A7X7QVW0 | 92-250 | None |
| A0A7X7BC70 | 803-967 | None |
| A0A5B9MAZ2 | 49-225 | None |
| A0A1Y0N2I3 | 2-172 | None |
| A0A7S3TN40 | 107-348 | None |
| A0A4Q7N1H7 | 330-502 | None |
| A0A356EVE9 | 340-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.