DPCstruct | MC32424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 201 ± 30 aa |
| Standard deviation of domain lengths | 30.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5ATH2 | 778-998 | LGKDESSKDLEKEDVASLSCSAANLPQSAEILGNQGNLLDKLKAVHLHVLAMEQWNASRLKLCHRNYLVSAANLIHYLALKSLDVEQ… |
| A0A511R6K3 | 1-194 | MQASEERAALEPLYRQISTLRAQVEQEGAAQYQRWLPYLKRPPFARSARNLADYLALRKHDLRLLQRELARLGLSSLGRAESRVREK… |
| F8XQ93 | 1-139 | None |
| A0A0X8WVE8 | 3-210 | None |
| A0A7R8L598 | 2-199 | None |
| A0A522XJD7 | 6-168 | None |
| A0A7J0EC99 | 473-670 | None |
| A0A3N3ZX33 | 1-280 | None |
| A0A0N1KHD6 | 1-237 | None |
| A0A522AFG9 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.