DPCstruct | MC32423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 64.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5ASN2 | 15-105 | IPIPVCSCTGNPQQCYRWGCGGWQSACCTTTISIYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLASEGYNFSNPIDLRTHWAKHGF… |
| A0A5P1FQI4 | 127-225 | FDESSMPVPVCSCTGKYQPCYKWGNGGWQSACCTTTISMYPLPVMPNKRHARVNGRKMSGSVFTKLLSKLASEGHDLSMPLDLKDHW… |
| A0A7G2EGL1 | 742-858 | None |
| A0A2H5PHJ0 | 316-423 | None |
| A0A5S9X4F8 | 154-271 | None |
| A2Y8V8 | 171-266 | None |
| A0A151RQK4 | 135-238 | None |
| A0A4S4E5Z2 | 309-412 | None |
| A0A6A6M8S5 | 6-118 | None |
| A0A4S8IDC8 | 158-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.