DPCstruct | MC32421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 134 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0665 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5AGI4 | 4-142 | QKRVPCFNSNKGAGEENGEVDDDLQFLLENDGLKVEQTMKKYSDELSATLGHMEQKLEELLDTVMSNCRLMTLAEKQQLQKLIQKLP… |
| A0A072V7K6 | 3-111 | NKLALEATYANKTRELSTELSNVETALRSLKTTMIAQCRKLSLSEKSRLANAIPKLSPDNLLKALEIVKENNPNFQHSIDMVTLNLE… |
| A0A0D2ZSB1 | 136-257 | None |
| A0A183W1Q7 | 258-402 | None |
| A0A453G9B0 | 10-177 | None |
| A0A445ALS7 | 96-221 | None |
| A0A445ALW7 | 171-290 | None |
| A0A7J8VTY9 | 43-198 | None |
| A0A6G1DV73 | 76-232 | None |
| A0A445IX19 | 417-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.