DPCstruct | MC32419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 154 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5A771 | 1-154 | MLAYVDFFLGGDEKRTDLPLRLHQRFPMSVLFGGDGSYMTPFYLHSDNIITSLMSQSVPPTTWYLFVAGLNAQLRLVRQGCLRAMFR… |
| A0A1Y1IIT2 | 392-531 | LGGDEKRSDLPPRLPDRLPLALIFGGEGGYMTPYHLHSDDLLTSLLGQMLPASIWYRMVAGLNAQLRTVRQGCLRRGLAPLLAWIGT… |
| A0A287KCP5 | 938-1073 | None |
| A0A453AA07 | 84-255 | None |
| M0XTZ7 | 116-266 | None |
| A0A7J8MGN6 | 1-152 | None |
| A0A834TBJ2 | 517-681 | None |
| A0A453E6Q5 | 210-345 | None |
| A0A446JQD1 | 264-425 | None |
| A0A7J0GCR3 | 238-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.