DPCstruct | MC32416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 172 |
|---|---|
| Mean domain length (aa) | 221 ± 42 aa |
| Standard deviation of domain lengths | 42.17 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 17.12 |
| Pfam Score | 41.09 |
| Assigned Pfam label(s) | PF13363- CL0301- CL0369- CL0105- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366NH90 | 377-675 | SDVIVKAGYLVRTANVDASTLALVGDVNATTPIEIVGGAPADLKTLTWNGQELSFEQSSHGVITATVDFSPPEIKLPCFSQLKWKTI… |
| A0A5J5A4A6 | 211-410 | EQVVASLPLATIMMLQLMNMAHVFKSESRPCAAFLSNYDPESSTKVTFENVQYDLPPWSVSILPDCKNVVFNTARIEAAEQRIYVDV… |
| A0A4Y7JRB9 | 69-298 | None |
| A0A5N4AF60 | 288-529 | None |
| A0A0C2INW8 | 110-270 | None |
| A0A0A0LWK8 | 22-223 | None |
| A0A3P6DB87 | 73-305 | None |
| A0A453SC66 | 20-201 | None |
| A0A7J6LVD1 | 351-645 | None |
| A0A2G5ENU9 | 298-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.