DPCstruct | MC32414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 200 ± 15 aa |
| Standard deviation of domain lengths | 15.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193- PF00395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5TD27 | 386-558 | SKFQLSAAMGSYDSSQAAAIGAFYHFNRDVMISLGGATSFDGDHKTAGNLGVTFRIGEGASGKAVSDDVMARLEAMDQKIAALEQEN… |
| A0A269TGP1 | 1-181 | MSCVIYRPNEDTMFSIGGSFGGGENMINAGVSLKIGRGNHVSNSRVAMVKEIRDLRQALAEQAAEIAQLKGMHHLAIDPDKSLLFPD… |
| A0A349N0B0 | 377-582 | None |
| R6WLN4 | 1-213 | None |
| F2BWQ5 | 717-920 | None |
| A0A380NI70 | 622-822 | None |
| H1D250 | 56-266 | None |
| R7M0H0 | 467-689 | None |
| R7LWL7 | 553-754 | None |
| A0A1C6F459 | 419-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.