DPCstruct | MC32410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 18.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0R1P1 | 741-870 | PITCGLSFHTSPPDSKKKADSVSCRSKDGLGYYCPSSKCLVPKPGKTEPITPFSDFTFENCDRLADKDLGAQTAIPVVHPVQFWTRK… |
| A0A180GSA6 | 1-130 | MLGRLWSVSFFVAHFTNARTTGFPATCSNDWSMDRREHVVRCPNVESETPVKCAPSSCSNFPICSSCVNVATQERHNSMTCRKGYNM… |
| A0A2N5VBZ4 | 524-642 | None |
| A0A2S4WIN4 | 202-378 | None |
| E3JZ71 | 83-233 | None |
| E3KXJ6 | 3-122 | None |
| A0A2S4VB10 | 2-158 | None |
| A0A2S4VIF4 | 57-195 | None |
| A0A2S4VV61 | 1-126 | None |
| A0A2S4V4E9 | 11-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.