DPCstruct | MC32409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 22.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7V8Z3 | 37-184 | EKERAERRKLIALNKLGEAAAIVRREWVRDKLLSRKTAPKGAALYLADVIVNRPDLFNDYHGQKLAPELLGLADNETAKMAVAKLPA… |
| A0A1E4BNL9 | 6-150 | KAERKTLIANNKEWDAAETVRREWLATLLTRKTLPKNAQTVTATSLATAGGVIAQALGHGNTVAASILGITDGHGSPRIADYLTGHP… |
| A0A0Q5N993 | 2-122 | None |
| A0A4R0TYI8 | 40-240 | None |
| A0A260A7W0 | 2-151 | None |
| A0A3E0VAB8 | 23-164 | None |
| A0A1E4I7S7 | 137-298 | None |
| A0A402DMR2 | 17-229 | None |
| A0A0Q5BWI8 | 310-458 | None |
| A0A5P9A032 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.