DPCstruct | MC32405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Standard deviation of domain lengths | 22.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7WJL3 | 43-216 | PDGTNYRAEVTEVTPALPGLRVRVVEGGARLELVNRTGRTIEVLGYAGEPYLEIRPDGVYENTASPATYLNRTLAGDTAVPAGADPT… |
| A0A1Q3NH98 | 2-170 | IGGIVPAGLGAGIEVRMLDHDAQVELTNRSGRRVIIKGYEGEPYARVESDGPVYLNLRSPSRPLSNDRFGLTLPTGQEDATAPPRWS… |
| A0A538J4B8 | 43-202 | None |
| A0A1C6ULS2 | 23-207 | None |
| A0A538DK39 | 28-203 | None |
| A0A543C2M7 | 327-456 | None |
| W5YM92 | 1-107 | None |
| W5YLU8 | 43-193 | None |
| S5AFA1 | 5-132 | None |
| A0A562DU48 | 23-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.