DPCstruct | MC32404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3NH79 | 1-67 | MASTGYMRWQQRGKGKWITVYSNPSHAYMIVAGLRFDTSMTPGNGPGWSTSPRSTPGRFAARHPGGF |
| A0A1M3BNQ6 | 33-113 | VSFALRGAKLLSTPLDSTSFETWGAPGAGRWITVYSNPGHAYAVIAGLRFDTAGGADGPRWYSSTAAAATGPFTARHPAGY |
| A0A7V9LGW2 | 319-399 | None |
| A0A7W0MUI9 | 1-87 | None |
| B4D913 | 89-169 | None |
| A0A5R8KDE9 | 93-172 | None |
| A0A6J7L308 | 361-444 | None |
| A0A2T4UHZ9 | 174-253 | None |
| A0A538KM79 | 216-298 | None |
| A0A7K0R6Q7 | 294-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.