DPCstruct | MC32403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 71 ± 14 aa |
| Standard deviation of domain lengths | 13.88 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.16 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0336- PF10590 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3ICI6 | 33-104 | IPSRQFLIDKRNELVRLAEEKGDDAITRPDCWGGYRLRPDYFEFWQGQSDRIHDRIVFEKSGNEWIIKRLSP |
| A0A1Q3NFU7 | 13-71 | AEATERFGDGDVPRPPHWGGFVIEPRSIEFWQGRGARLHDRFRYERRPDGSWAVTRLAP |
| A0A0N0SQH5 | 70-148 | None |
| A0A2S7NXH2 | 79-133 | None |
| A0A7D9EVW9 | 67-148 | None |
| A0A0P0XTK4 | 241-325 | None |
| A0A5N6K6L7 | 163-234 | None |
| A0A7C6TIL5 | 2-61 | None |
| A0A3N5Y2U9 | 45-95 | None |
| A0A2J7PGW7 | 250-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.