DPCstruct | MC32402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 8.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5Y9K9 | 1-93 | MTEHRTIQWEGRGIRLSYTPRWATQIDHVEMHALDGAPLPVTETGYRSHFFGPVDPVLTMDEVEVMMRDWLDSEAAKPAWQEHLKSA… |
| A0A1E1F1E3 | 3-106 | RTFKRYIEHYETVWHGVTITISYEPRWLSLADDYGLDTAHLEIEAIAPERAPLPITETGYRSHFTTAHAVAAMGGPVALVRTWLDEE… |
| E2CAN2 | 2-81 | None |
| A0A257JMT6 | 72-172 | None |
| A0A2D7XQP0 | 2-83 | None |
| A0A7C8LP98 | 27-122 | None |
| A0A1W2EBR7 | 2-84 | None |
| A0A372EVF1 | 1-83 | None |
| A0A3B0ME20 | 37-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.