DPCstruct | MC32400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S2YKQ4 | 83-212 | FPEYLQEVEKITNREIKPNQMEKLQRALKEQEFVKLDPEKSKLHRKLFDNAKDKLIDEWEKNTGDKWPVYAQDVLNDAGEVIRKAGQ… |
| A0A1S1CG64 | 7-121 | FTLGLLKYIRTHGTVKPSQQELARRRAEFGKNRDALIREWEKNTGKKWPTYTEPVISSRTGRLIKPTGSKYDAHHIQPLENNGGNIW… |
| T0P0S2 | 8-129 | None |
| A0A6A8SKH5 | 26-190 | None |
| A0A5B9MKA0 | 362-501 | None |
| A0A1D2P8M3 | 164-279 | None |
| A0A3R8VZZ5 | 201-338 | None |
| A0A7Y9XQV6 | 230-369 | None |
| A0A3D8TQP3 | 365-502 | None |
| A0A1S9XQZ9 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.