DPCstruct | MC3240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.39 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E8R2X8 | 1-68 | MNGTRQALVLWENVRPEYRIMILNNVWCGQCGKGVGIANPYATVLKGDILLDGTCVTCGSKVARYLEM |
| A0A7Y3DSR4 | 177-251 | PTKALDEFSLTPQAFRIWINIPGDIQIKILNNIWCITCSDITSIRSVRGKAQKGMLILKGICTRCGNPVTRAIEN |
| A0A2H0ZAG0 | 9-77 | None |
| A0A0W1A0F6 | 134-197 | None |
| A0A1M6RJW2 | 111-176 | None |
| A0A1I6DZI2 | 21-83 | None |
| A0A2A4TNJ9 | 2-67 | None |
| A0A3N5B0E5 | 4-68 | None |
| A0A1V5C3A6 | 88-153 | None |
| A0A0F9HA40 | 14-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.