DPCstruct | MC324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.15 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0036- PF03830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HTD4 | 75-176 | EREWLGERQSAQLCATLEQVMREQPQQWSRYYHGTPHQQYLDRHYSLSDRVRYYWPQPQVQQAVDGLLDNLRRSPAPLALLSQYLPD… |
| X5P2Q2 | 16-125 | ITDYGDRSLARTMEGAMLAAPGHWHSHYHGNEAELYVQRHYSYSDRIRYYWSNSTAVAAVEHLRKALDGVAIPETLMRQFLPALPAE… |
| A0A7H4M842 | 163-295 | None |
| A0A8A7KE67 | 100-232 | None |
| A0A7H4S5W5 | 3-124 | None |
| B8B2J4 | 513-634 | None |
| A0A6J4YIL2 | 77-187 | None |
| A0A4U9ITC6 | 38-134 | None |
| X0ZBY2 | 1-117 | None |
| A0A379D7Z0 | 71-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.