DPCstruct | MC32398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D3FHZ5 | 127-228 | GTSVSDMVLAANTLIAQQGGYLVARDGTLVANAHLEIGGIVSDGPIGTLAREIRGVRKAMRALGYEHVNEIMSFSTLSLLVSPHLKI… |
| A0A662UAD0 | 42-133 | MLTVIKHLKKIHGGFAVVNNGEVLVDLLLELAGLMATKPAEHIIGKLIELNENEIVRTKLSATVKAPFMLFQFITLLTVPELGITDQ… |
| A0A1V2K2B5 | 8-101 | None |
| A0A7W8FXH0 | 619-725 | None |
| A0A2A5NX62 | 91-192 | None |
| R1EPQ5 | 163-289 | None |
| A0A3R6N4Q1 | 498-600 | None |
| A0A3R6QNZ7 | 138-240 | None |
| A0A7C4AV70 | 280-382 | None |
| A0A6C1QJU3 | 186-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.