DPCstruct | MC32395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 153 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0HAA1 | 1-157 | MKVERIDTKKTMNVQSYFIENYKDQKAYEGHYLHYDIEISQKPVNLKVYEGDYIVYTDQTSNNYIMATLEPQHPDSFFAWNFMDGIL… |
| G8R6V2 | 415-571 | IMEPLKSDTIINVNSYYIQNPKFSNYPYEGHFPLRDMEVEIKYQQRAFLAGDYLVPTKQKNIRFIVSMLEPKAVDSYLRWNFYDEIF… |
| A0A7Y1W316 | 1-151 | None |
| J8SGL5 | 79-232 | None |
| A0A7W1LC81 | 190-344 | None |
| F3BKU2 | 97-250 | None |
| A0A1V5KNL7 | 265-421 | None |
| A0A1C3NM34 | 9-132 | None |
| A0A1Y1R8K3 | 360-527 | None |
| A9GRU3 | 880-1033 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.