DPCstruct | MC32393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 169 ± 39 aa |
| Standard deviation of domain lengths | 39.39 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9AGW9 | 3-141 | KIMLRQGIKSLQDPKSLVSRYVGSFAWTILVLITLMSFLLYLMYWKTNRLYVEHFIFTMHQQSGAFMILTLLFAFNDYILDIEWLGL… |
| A0A2E6B3M4 | 174-318 | LLPLVVDALVSPKRTFDVLIDNVAIAIFVFLPLYALVLKLFYLGVNRRYYIEHLVFAMHLHSVGFIVFTALACIAFVGRQGNSPTAA… |
| A0A136P128 | 27-195 | None |
| A0A7Y3DWH7 | 12-133 | None |
| A0A3D2XGB9 | 59-210 | None |
| A0A7V9MSA5 | 168-335 | None |
| A0A848V9R1 | 39-237 | None |
| A0A5B7TVB6 | 232-382 | None |
| A0A6L8HCF0 | 39-172 | None |
| A0A0C1IBG5 | 144-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.