DPCstruct | MC3239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 324 ± 20 aa |
| Standard deviation of domain lengths | 20.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9K4M3 | 408-739 | RLRRNLYPPRNPNGSKYVSINLHEVNTGIIRHVVFGLPFGSLEMQGPKPGDSTGGYLVFEVMDDKKAHPKAWFGVPSIGPFENFDRA… |
| A0A5Q4C1S1 | 128-468 | RTRSKVNNDRGKHIFSVKFSMSRTDENVSCFWWFSHTFEIDSPPPVGTPLVVIIESMDDGKPHQTPWFLGPRHGAWDNFHELHSFSL… |
| A0A0F7ZUJ6 | 413-754 | None |
| A0A163FYE5 | 376-698 | None |
| A0A6A6CEE8 | 675-1004 | None |
| A0A6A6Q206 | 1-336 | None |
| A0A420Y867 | 1-306 | None |
| X0MM19 | 91-395 | None |
| X0M131 | 227-518 | None |
| A0A096PF14 | 347-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.