DPCstruct | MC32389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0023- PF04031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9AR09 | 1-134 | MSLIRFVNGLVDPLQQFSFARSIYHLAKQIDLPLKFVQLRHSSTHENLPSLKVLVHSTNEAIDWLKFKYWDVVLSTLEDSSTPLTSL… |
| A0A1Y2CMK6 | 68-178 | GLVSEHELRLMYSIAFVRFVNGVVDAQQKGVYAGSVAGIAESLGLPAWFVDLRHSGTHDRLPSISLLRSGCHQALDWLNTNYWIVQT… |
| A0A5C6MQR9 | 88-190 | None |
| A0A150G751 | 114-235 | None |
| A0A0C9M5A8 | 73-197 | None |
| A0A3R7GZV6 | 309-421 | None |
| A0A316W391 | 97-209 | None |
| A0A7S4BLB4 | 86-199 | None |
| A0A1V2LDZ7 | 42-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.