DPCstruct | MC32382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 319 ± 41 aa |
| Standard deviation of domain lengths | 40.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444EXR5 | 2-289 | AVFKDMLHELQIGRENRDGADQGFLVSYFSDLLDRPMFHPPANDTKLHGTYRLPLGYQMDASYYYLKLRWHVPCGPNSVITFPSMPW… |
| A0A5N6MM78 | 162-454 | FINPCIFHTGLFVLQPSSKVFKNMLHDLDNKRDNPDGADQGFIGGYFPDLLDQPMFHPPPNGTKLDGTFRLPLGYQMDASYYYLRLR… |
| A0A5J5TXZ8 | 1-328 | None |
| A0A0B0NG03 | 150-390 | None |
| A0A0E0PBL6 | 160-484 | None |
| S0F3T8 | 13-345 | None |
| A0A5D2XB70 | 35-390 | None |
| A0A2G2XKZ3 | 134-413 | None |
| A0A5B6X083 | 768-1152 | None |
| A0A7G2F8J2 | 146-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.