DPCstruct | MC32380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1CEP2 | 3-81 | NDKQFEFCVVCKLNHNQRRRHNFLPNHKKSLAAVLSRFQSKLSDIRFFLKNPIPLRPEHASLNRLWCIFCECDILELDS |
| A0A444EKT7 | 196-283 | KSSGENGQAFEFCEVCRLNHDQGRRHKYFPSHARALAAVLARFHGKLSDVRFFLRNPSSLSPEHAVLNRLWCLFCRCDLRELGSSFAW |
| A0A836DN92 | 8-90 | None |
| A0A178UZV7 | 1-88 | None |
| A0A218XZR7 | 24-116 | None |
| A0A2G5E5T3 | 1-95 | None |
| A0A6A4Q3P5 | 1-85 | None |
| W1NJ27 | 2-91 | None |
| A0A7J7DBP5 | 15-104 | None |
| A0A0B7ABB5 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.