DPCstruct | MC3238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 173 ± 16 aa |
| Standard deviation of domain lengths | 15.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428S5Y2 | 2-156 | AWVLHMKLLSDLDAPEGTVPKWEVYLEVSAHDVPKLMREGFYWSEANVDHERGEFTIYPREDNTNLVRFSRTYYLEDLHEDPQWMAQ… |
| A0A5Q4BU48 | 3-152 | CSASTQTRDTSHQTTTQAVCHNMILAHYSDVDHQIRHDHSRMEWEALFYVQANDVARLLREGLHMSEGNIVPGTGCITPGACPDILG… |
| A0A1J7J791 | 48-217 | None |
| A0A2N6NHK5 | 17-189 | None |
| A0A428NAZ0 | 71-245 | None |
| A0A2T3ZDX2 | 190-360 | None |
| A0A151GX28 | 151-320 | None |
| A0A2L2TEY5 | 35-234 | None |
| A0A066X7X3 | 3-185 | None |
| A0A5N5NFX7 | 231-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.