DPCstruct | MC32379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 386 ± 52 aa |
| Standard deviation of domain lengths | 52.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438DTV6 | 12-377 | ADIEEAKTQENAKLQNALQDMQVQFQETKEMLIKERENAKKADEKVPIIQEVPAIDHEMMNKLTAENEKLKDLVSSLEKKIDETQRK… |
| A0A444EFB2 | 1-311 | MQRQVEEARSTLIREREAARKAIEEAPPVIKETPVFVQDTEKIDLLTAEVENLEALLLTEKKATDAANKAYAEAQETNNKLVKKVED… |
| A0A5J5C9E6 | 190-556 | None |
| A0A452ZP49 | 349-728 | None |
| A0A5J5BJP6 | 35-374 | None |
| A0A445GAH2 | 8-444 | None |
| A0A446UM26 | 1-494 | None |
| Q9LKB9 | 878-1320 | None |
| A0A834GZP4 | 197-549 | None |
| A0A453DWK8 | 156-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.