DPCstruct | MC32373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 246 ± 57 aa |
| Standard deviation of domain lengths | 57.41 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2N4Y1 | 30-266 | VQRFIADNQLDERAGDALLQAPPAVQRAVMERGSLLETRNPSSALLGRLRDASQGGASMGRADDRDQGGFRDQGSFRDQGNFRDQGS… |
| A0A7S4S289 | 151-494 | RSQAGAAAELLAWGVLDEGSADFLAKAPEREAREIVASLGPDVRNPSAFVTRKLKELRLELSAGHRAEAAPPVCAHVLVHRNGAPVQ… |
| A0A7S1F5T4 | 62-376 | None |
| A0A1Q9EI34 | 14-234 | None |
| A0A1Q9E5Z1 | 1-344 | None |
| A0A813FWP7 | 12-291 | None |
| A0A812TIX3 | 4-233 | None |
| A0A812QWT5 | 10-354 | None |
| A0A812QPJ8 | 499-711 | None |
| A0A812QII1 | 16-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.