DPCstruct | MC32372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 273 ± 20 aa |
| Standard deviation of domain lengths | 19.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0062- PF04749 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3PCP6 | 97-370 | LGPILTVIFIISLAIYFATSSDSGSLIVDFLASNGRLHHHWLQRLFWAVTEGAVATALLTAGGSDALSALQAASIVCGLPLCVLLCY… |
| A0A813JGU6 | 501-779 | YWFDLMGQYHGMGPFLVVVSLITTVLYFVTSSDSGSLVVDLIANNGRESHVVQRVFWAITEGAVAIALLRAGGQESLKALQSISICA… |
| A0A7S3AL85 | 707-991 | None |
| A0A1Q9E309 | 905-1185 | None |
| A0A7S3SYP1 | 2-230 | None |
| A0A830HFT3 | 5-273 | None |
| A0A6S7IFD7 | 2-235 | None |
| A0A1V9YGJ1 | 44-326 | None |
| A0A7M5US49 | 36-298 | None |
| A0A7S4GMP1 | 217-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.