DPCstruct | MC32370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 138 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4SIW9 | 115-244 | FKLMIQHNCNLGGFYPTNYPLSMVRQPNITTDLRFIHDPITLIRNQKLMLNERFAYKMDFERTIQYYKQDKRVFRLNHYTFCTAYNP… |
| A0A813CFZ4 | 342-482 | AARFIVAKMRASPDKPKLGGVYMLGSCARTFAGPEFVDHHFILGDFFVVDKGSSVRFDENMKLKEDYDFTCAHLKAHGSVLRCNRMT… |
| A0A7S1W0G5 | 1-145 | None |
| A0A7S1S9D4 | 280-428 | None |
| A0A373PT34 | 56-171 | None |
| A0A813D9T4 | 373-499 | None |
| A0A1Q9C2Z8 | 108-253 | None |
| A0A7S2FE76 | 66-189 | None |
| A0A812ZVQ3 | 188-331 | None |
| A0A813FZY8 | 224-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.