DPCstruct | MC3237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 187 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.13 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF17106- CL0587 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428SQG0 | 6-181 | IFGVITGAIALTETLLKLYKAIETRNDLPEAFLEVGKRLPLVEEILELAKGLTDGLEEEHQETQALKQNLDDCHSKLSQLHEIFRQI… |
| A0A5Q4BL19 | 2-184 | VSGIEIAGLISAIITIVDTAIDFCDAIKDLDGLPEAFKQVHARLPLVREILLDAKGLAKNADENEASALKSGLENCQEKAEELKMIF… |
| A0A2T2N136 | 4-188 | None |
| A0A0F7TTD0 | 232-424 | None |
| A0A5Q3FUS8 | 2-193 | None |
| A0A3M9Y347 | 2-198 | None |
| A0A2H3I8K5 | 7-213 | None |
| A0A2P7YFX9 | 5-200 | None |
| A0A384JI36 | 1-204 | None |
| F2S8R5 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.