DPCstruct | MC32366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 31.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D4LZP4 | 32-167 | LDLKGKSEQQLLKEMDYQTRRNIKRTDEMGVKVRQLPIEETDRFFKLFKMAEEKHGFSFRDEPYFKQLQRDYQGYASLQLAYIDLNE… |
| A0A380EGV6 | 1-121 | MDFCIGLKDKDENQLLKEMEYQTRRNIKKTIEIGVKVEDLSIEETNRFYKLFQMAEEKHGFHFMNEDYFKRMQEIYKDKAMLKIACI… |
| A0A7I8NMR1 | 1-138 | None |
| A0A380EHI3 | 1-134 | None |
| A0A811IDX8 | 30-163 | None |
| A0A4V0EWH9 | 152-283 | None |
| T0SZZ9 | 378-507 | None |
| A0A1L7LKH3 | 10-149 | None |
| A0A7Z7QYJ2 | 121-259 | None |
| A0A380NZH6 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.