DPCstruct | MC32361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8IUR1 | 1-67 | MSIMGPKLKQGYKIAQCCSPQPNDPIIGYFSYNNIVVVHKTSCGNLKKAESERLISLSWKDILEKKE |
| A0A380E2B0 | 32-103 | SLPIKDNIITDSGVYVEGLENVLIKLSKCCNPIPGDDIVGYITKGHGIKVHRTDCPNIKNETERLINVEWVK |
| A0A2V7J4N5 | 804-868 | None |
| A0A6I1JAN2 | 104-183 | None |
| A0A2N2XP66 | 370-455 | None |
| A0A7Y2DZ10 | 3-65 | None |
| A0A485BWX2 | 40-114 | None |
| A0A849T881 | 9-87 | None |
| A0A2D5FUD5 | 42-104 | None |
| A0A855HTV8 | 18-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.