DPCstruct | MC3236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N9N4I0 | 132-298 | HCMLFASICRHRGIPVRIRAGFAKYIGEDDRIRVSHVVCEVWDHEQNQWILVDPDRQRVDFPRHEFEFAYETWGRLRSNNLDKNQYV… |
| A0A850CYK0 | 30-199 | GFDHDHVVAEYFNGERWVMIDAELEPGSKPFDVGDMPAGPFRSAAEVWLGYRSGELDGDRYGANPEPIGDLKLFGGWFIRNYVHYQL… |
| A0A7Y0PDT4 | 87-232 | None |
| A0A239P8D1 | 79-225 | None |
| A0A358U0C2 | 1-133 | None |
| A0A381I5P7 | 114-269 | None |
| A0A256W8C7 | 257-423 | None |
| A0A838UV18 | 116-280 | None |
| A0A849IHK1 | 18-161 | None |
| A0A0X3UTS3 | 59-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.