DPCstruct | MC32356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380DQI9 | 1-87 | MISFCQSIQHASPINAHFSPEPSYMPGYEDDVIMAAGTFIQGSSIELSADGPIRPPYEAYVQGGLTYEHVKIAVTRAVKQLKEQGLI |
| A0A2G9G3W2 | 106-209 | YKVQPGCRVPRHDVVQAVELGTRERLLAFCEAVQKSSPVSSFTKPIAGATPGYASEVIFADGTFIDGSTSELSCDGPLREPYAVYCQ… |
| A0A1W1VQL0 | 329-426 | None |
| A0A830I1T7 | 356-451 | None |
| A0A2U1PM31 | 3-83 | None |
| A0A0E0GKL5 | 109-230 | None |
| A0A811QSL6 | 316-390 | None |
| A0A7S0J2I6 | 36-126 | None |
| A0A7X8L0T5 | 39-149 | None |
| A0A7V7BH23 | 210-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.