DPCstruct | MC32355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 58 ± 2 aa |
| Standard deviation of domain lengths | 1.62 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 93.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8WPT4 | 107-163 | AISQQPLFVPGVWGPYLSSMVPDMWLNEGGQSATGRLLDHVVKSHAAYPQLQEQVQR |
| A0A453NIX0 | 35-91 | AVSKNKLFIPGVWGPFWSAMIPEYWLTEGGQSATGALLDYIVENHAAAPLLANHAAS |
| A0A6D2HG11 | 1-58 | None |
| H3AH82 | 7-63 | None |
| A0A377CXK9 | 71-130 | None |
| A0A3P5HDW8 | 1-58 | None |
| A0A401PUN1 | 84-139 | None |
| A0A7R9PLY7 | 1-61 | None |
| A0A5N6XCG7 | 3-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.