DPCstruct | MC3235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239EVD1 | 272-356 | TEPTSASATASAVPPPPAPASTPAHGFTAQQARDPQTPGEVLARIVQDAPELRSDVAANPSTYPALLDWLKLLNDPQVNAELAAR |
| A0A7I9V842 | 13-84 | VPSTPAMPAQGGFTEAMAADPSTPAEVLNRIAADAPHLRPALARNPATYDDLLTWLGSLGDPAVNAELARRP |
| A0A163R7Q3 | 115-200 | None |
| D1BEZ6 | 547-626 | None |
| A0A6G9CM64 | 445-523 | None |
| A0A086ZGV2 | 82-174 | None |
| W4NA38 | 127-217 | None |
| A0A554VWH3 | 78-169 | None |
| A0A2N3G3I5 | 93-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.