DPCstruct | MC32346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 212 ± 40 aa |
| Standard deviation of domain lengths | 40.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 84.93 |
| Assigned Pfam label(s) | CL0023- PF08155- CL0669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6L4F1 | 16-237 | KTALLVATRSTMVNQPNNLQSLEGISEDDMKLVEEMKLEAMKISVVEGQQVLLTMSTLTKEGVTVFHVAMPKPCDQKERHVCIPESI… |
| L5K785 | 8-208 | FPVVETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAVPNKRDDKERPPFIPEGVVARRKRMETGEPRRKRERDI… |
| A0A197JRP3 | 152-316 | None |
| A0A4U0WWH5 | 286-495 | None |
| F0VGG3 | 273-530 | None |
| A0A7R9HI60 | 47-248 | None |
| M3US28 | 1-174 | None |
| A0A7J8VR90 | 2-189 | None |
| A0A183HG39 | 92-290 | None |
| A0A183WA06 | 19-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.