DPCstruct | MC32343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 57 ± 1 aa |
| Standard deviation of domain lengths | 0.83 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 91.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 74.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5U592 | 8-64 | APELYRGVIAKVPFVGVLTTMLDPSIPLTTGEYEEWGNPNNKEDYLLIKSYSPYDNI |
| A0A453P3I6 | 57-114 | MRPDLFKAAIVGVPFVDALTTMLDPTIPLTTAEWEEWGDPREEEYYYYMKSYSPVDNV |
| A0A2P6QBQ0 | 95-150 | None |
| A0A4D6N761 | 629-686 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.