DPCstruct | MC32340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.52 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF08033- PF04815- CL0375- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5M0W7 | 40-138 | APAEYMVRPPQPPVFMFLLESTYQAVASGALASAAAAIKELVEKKSFPGGERALVGVMTFDSSIHFYNLNSRLSQPQMLVVSDLEDP… |
| A0A2J6KXR1 | 31-117 | KECRCVLTIQPAFVFVVDGSSIEDELQALKNELLLIVAQLPENAMVGLIVFDSMVRVYDLGFTECLRVVVLHGECKPSSSQVLERLT |
| A0A7J0E5G4 | 582-663 | None |
| A0A2V0PPG6 | 116-201 | None |
| A0A4S4EPB0 | 126-212 | None |
| A0A368G6H5 | 128-197 | None |
| A0A183J790 | 125-196 | None |
| U6MT85 | 1-107 | None |
| A0A0C9YV79 | 90-180 | None |
| A0A0C9YUL1 | 98-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.