DPCstruct | MC3234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6BRN0 | 40-152 | IDENLMRHDLTTLERAEHLTRRNEILLALGQRAPDHRPDKGLTIRPLRTTADMAGDVGVSKSSFQHHLQIGRAIPADVRDAIRSTPT… |
| A0A0P1ILP8 | 4-110 | LDENLMRSELTITQQSEHIAKRKELWEARKQSGRNPPTSDPRQGFASATSDATGMSKRRVNEAIARAEGVTQEARDTIRGTEHDKGV… |
| A0A4Q1V738 | 11-123 | None |
| A0A1M3QA28 | 3-108 | None |
| A0A413FWK2 | 3-115 | None |
| A0A850B3L4 | 116-257 | None |
| A0A4U1H8L5 | 452-577 | None |
| A0A021XGM4 | 9-126 | None |
| A0A2S9INU5 | 3-94 | None |
| A0A1H9QC62 | 107-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.