DPCstruct | MC32338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453S3G0 | 14-81 | LGRTAIVSSKTKESRKVFTLHLSREALLEKSSSKLSWKTAGGVRDPSEEELALSPHRSFTQVEIHGLN |
| A0A2J6KWP4 | 1-96 | MFGYGGFDASLHLGRHTKVSSKTKDSEKVYMLRLEREALISGSGSGSKQTWRTYGSLRDPMKEEIQLAPCGSFTKATQMQIEGYLLS… |
| A0A7J6W605 | 29-112 | None |
| D7M321 | 60-152 | None |
| A0A0V0HUS2 | 182-269 | None |
| A0A438HX14 | 25-95 | None |
| A0A2U1LA81 | 41-108 | None |
| A0A6I9SHW7 | 40-125 | None |
| A0A1U7XPM4 | 2-106 | None |
| A0A5D2ASF4 | 41-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.