DPCstruct | MC32337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 5.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2GEL6 | 196-287 | ENCLDSLGVVVAAGPFATADTMSYEPLWDLMKYVKTHMPHVVILIGPFVDVKNDFIENGDLNETYDDIFKRLVLEILKNIESLSTKV… |
| A0A194PG77 | 2-89 | LVVAGPYTTSDNMSYEPLKDFITYVGNHRPHVVIMTGPFMDCDHTKVKDNTMAETYKSFFDKLVDSLGELTAISPFTKVYIVSSSKDV |
| A0A654I247 | 272-360 | None |
| A0A7J7MTE4 | 249-338 | None |
| A0A077WUZ5 | 324-415 | None |
| A0A0D0UX62 | 444-533 | None |
| A0A183J9T5 | 111-216 | None |
| E9IBJ5 | 217-303 | None |
| A0A183HMH0 | 11-97 | None |
| A0A5J5D8F2 | 602-688 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.