DPCstruct | MC32336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9ULD8 | 70-167 | IVGIPTSKITHEQALSLGIPLSDLDSHPVVNLAIDGADEVDPFLNLFKGRSGSLLREKMVKNTCKKFIVIVDGYNLVNYIGGVDWPC… |
| A0A5N5MMG6 | 28-129 | TDIIGVPTSKRTEEQARSLNIPLSILDDHPHIDLAIDGADEVDPLLNLVKGRGGALLREKMVEAASDEFVVVADETKLVDGLGGSKL… |
| A0A814UVR5 | 53-128 | None |
| A0A2H3BP50 | 71-157 | None |
| A0A2X5SAF7 | 48-129 | None |
| A0A4Q5UIA8 | 50-145 | None |
| A0A7J7DVG6 | 373-468 | None |
| A0A432J152 | 4-98 | None |
| A0A5N9VZ30 | 42-130 | None |
| A0A6M2CKK8 | 60-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.